PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp1222s0073.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 442aa    MW: 48322.2 Da    PI: 9.2125
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp1222s0073.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.81.7e-31184241159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +dDgynWrKYGqK+vkgse+prsYY+Ct   Cpv+kkvers  +++++ei+Y+g+Hnhe
  Kaladp1222s0073.1.p 184 VDDGYNWRKYGQKQVKGSEYPRSYYKCTCFCCPVRKKVERSP-EGQIIEIIYKGQHNHE 241
                          59****************************************.***************8 PP

2WRKY105.82.2e-33358416159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDg++WrKYGqK+vkg+ +prsYY+Ct++gC+v+k+ver+++dpk v++tYeg+Hnh+
  Kaladp1222s0073.1.p 358 LDDGFRWRKYGQKVVKGNSHPRSYYKCTTPGCNVRKHVERASTDPKSVITTYEGKHNHD 416
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.1E-28177242IPR003657WRKY domain
PROSITE profilePS5081122.997179243IPR003657WRKY domain
SuperFamilySSF1182901.06E-24181242IPR003657WRKY domain
SMARTSM007748.5E-33184242IPR003657WRKY domain
PfamPF031063.2E-24185241IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-35344417IPR003657WRKY domain
SuperFamilySSF1182909.29E-29350417IPR003657WRKY domain
PROSITE profilePS5081135.645353418IPR003657WRKY domain
SMARTSM007743.8E-39358417IPR003657WRKY domain
PfamPF031067.6E-26359416IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MANAPVPSSH HHPRPATIAL PPRASAESFF ASGFPGFSPG TMTLVSSLFA ADDPRSFSQL  60
LAGAMASPAA PADKEDSMYK QKRPLNLEVS APPLFMVLPG ISPSGFLNSP GIFSPLQSPF  120
GMSHQQALAQ VIALAQSSMQ NQAGTGSYKP PSTLEPEIAS IAPSEVFHAG PKSQPPTAAS  180
DKPVDDGYNW RKYGQKQVKG SEYPRSYYKC TCFCCPVRKK VERSPEGQII EIIYKGQHNH  240
EQSPPKKSAK DGNDPIEDVR SQAMPDDNRL DKAEVPKRPT EAPPEQIVHE KDEKFRQETS  300
VDSRPLSTDE TRGNADSENG PMLKKRNSGS AVGEPNLPQK TVVEPKIVVQ TRSEVDLLDD  360
GFRWRKYGQK VVKGNSHPRS YYKCTTPGCN VRKHVERAST DPKSVITTYE GKHNHDMQKG  420
RSNGRQHIRQ SSPTEITDGG R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-39184417876Probable WRKY transcription factor 4
2lex_A3e-39184417876Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661104.11e-147PREDICTED: probable WRKY transcription factor 4
SwissprotQ9XI901e-122WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLF6H5W31e-147F6H5W3_VITVI; Putative uncharacterized protein
STRINGVIT_14s0108g01280.t011e-146(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-101WRKY DNA-binding protein 4